<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29986
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MVSMGMQQQRPQTSIGNISQASQMAFGQQIFRNFIVLLFYGIQMQAGPNASSQQAVPSPKPPSISSMMMSPSPQGMVANPRGNSPRVLNTPGGPNSPSPNTPRSHEEQAYLDKLKQLQKYIEPLKRMINRLTTGKDEESKKDISKMENLLKILTDPSKRLPMATLLKCEQVLDSLEMAKPPGVGSVPSATTTITSTPMHMCQPLLDAVATNMKSPMFNHALQQTFGPAMTALFGAPISFKTFSK |
| Length | 244 |
| Position | Tail |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.373 |
| Instability index | 60.72 |
| Isoelectric point | 9.79 |
| Molecular weight | 26622.68 |
| Publications | PubMed=22992520
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29986
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.59| 16| 30| 44| 62| 1
---------------------------------------------------------------------------
44- 59 (30.86/18.49) MQAGPNASSQQAVPSP
76- 91 (28.73/ 9.18) MVANPRGNSPRVLNTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.12| 27| 30| 101| 127| 2
---------------------------------------------------------------------------
101- 127 (46.70/37.04) TPRSHEEQAYLDKLKQLQKYI.EPLKRM
133- 160 (39.42/30.20) TGKDEESKKDISKMENLLKILtDPSKRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 13| 31| 168| 181| 4
---------------------------------------------------------------------------
168- 180 (23.68/17.25) CEQVLDSL..EMAKP
201- 215 (19.97/ 7.45) CQPLLDAVatNMKSP
---------------------------------------------------------------------------
|