<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29983
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MELSTIALPYGKIYHLFLSFCQEDEERIDDLCNEIVEELNTSRYRTRYILYSASFWGRLWCFLVLGAPALTVLPLLIVLIKEGEITEQTLAGVCSTLVVVPIVAVSIFLCCCFGKNMIKGRKLLEKITWKHLSTNYQTLMVLPLIRSTEEKQNGGKMNEPIRRPEQGSPRSSPRGSRSPAYPRTDSSGTLKTTISLGRVPSVIHSGPFYLVKDIGPAHPSHSGITGSTNLMIHYGLQNSYSKFCKKEGKEELSAFLPNLPGYIDTPGMQDNSSLRSLIENPPKTSKELVPLSGPALQGFRLHPGPLPEQYRFMSHMPRKKHKLKKKEREREKPGNMQDAQDNSPEVKTKKVKTEEKKKKKKKNKKKAKEKDDGSLFISIPPT |
| Length | 382 |
| Position | Head |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.511 |
| Instability index | 47.35 |
| Isoelectric point | 9.55 |
| Molecular weight | 43041.54 |
| Publications | PubMed=22992520
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29983
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.86| 13| 35| 318| 332| 1
---------------------------------------------------------------------------
318- 330 (22.07/ 8.52) RKKHKLKKKERER
358- 370 (20.80/ 7.43) KKKKKNKKKAKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.00| 17| 68| 60| 76| 2
---------------------------------------------------------------------------
60- 76 (31.70/20.79) WCFLVLGAPALTVLPLL
129- 145 (32.30/21.30) WKHLSTNYQTLMVLPLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.61| 22| 35| 246| 267| 3
---------------------------------------------------------------------------
246- 267 (39.97/25.30) KEGKEELSAFLPNLPGYIDTPG
283- 304 (39.64/25.03) KTSKELVPLSGPALQGFRLHPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.92| 19| 35| 179| 197| 4
---------------------------------------------------------------------------
179- 197 (33.45/20.53) PAYP.RTDSSGTLKTTISLG
216- 235 (32.47/19.75) PAHPsHSGITGSTNLMIHYG
---------------------------------------------------------------------------
|