<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29980
| Description |
Cyclin-C |
| Sequence | MEKKENQEFGVISNSRLMTTCQTVVKNKFSHAYPQEYPYRINSVLECEFFLLEMMDCCLVLYHPYRPLTEYFKELAHEDSLYPLAWRIINDSLRTDVCLLYPPYLIALACLHIASVIQQKDLKQWLAECSVDMDKSIIATRCRCSATGQSAKCCVMRKHIMGKPTDFCSSFQKTEQN |
| Length | 177 |
| Position | Kinase |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.189 |
| Instability index | 42.07 |
| Isoelectric point | 6.92 |
| Molecular weight | 20587.78 |
| Publications | PubMed=22992520
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29980
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.99| 18| 23| 127| 145| 1
---------------------------------------------------------------------------
127- 145 (30.09/19.17) AECSVdMDKSIIATRCR.CS
151- 169 (32.90/16.76) AKCCV.MRKHIMGKPTDfCS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.83| 18| 23| 48| 70| 2
---------------------------------------------------------------------------
39- 64 (24.35/22.90) YR..insvlecefF.LLEMM......DCCLvLYHP
65- 83 (20.98/14.53) YRPL......teyFkELAHE......DS...LY.P
86- 103 (20.50/10.67) WRII................ndslrtDVCL.LYPP
---------------------------------------------------------------------------
|