| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MPCFATKNPPKTSKELVPLSGPALQGFRLHPGPLPEQYRFMSHMPRKKHKLKKKEREREKPGNMQDAQDNSPEVKTKKVKTEEKKKKKKKNKKKAKEKDDGSLFISIPPT |
| Length | 110 |
| Position | Head |
| Organism | Crassostrea gigas (Pacific oyster) (Crassostrea angulata) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia> Autobranchia> Pteriomorphia> Ostreida> Ostreoidea> Ostreidae> Crassostrea. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.479 |
| Instability index | 45.68 |
| Isoelectric point | 10.16 |
| Molecular weight | 12689.80 |
| Publications | PubMed=22992520 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP29977
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.77| 18| 37| 46| 64| 1
---------------------------------------------------------------------------
46- 64 (27.95/14.84) RKKHKLKKKEREREkPGNM
86- 103 (28.82/11.79) KKKKKNKKKAKEKD.DGSL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) CFATK 2) KTSKELVPLSGPALQGFRLHPGPLPEQYRFMSHMPRKKHKLKKKEREREKPGNMQDAQDNSPEVKTKKVKTEEKKKKKKKNKKKAKEKDDGSLFISIPPT | 3 11 | 7 110 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab