| Description | Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MAEQDLSKIHITLDSKLIDEHVDAFLPDELVFKAQLVPRIIHERGPFVDINESDLIKEIASLNAQQNSDNDVDMDQDDHDNLEETPDDDDQLINVNETFTKNKIEALKFISTALNESSLALDFVSLLISCVRPAAGTISMSQHLKKFVPPGSLNSDIVNQVTTPQERELRMKNEKIIGQGWKLSSLESSSNKLRDSSIRLSEEILKEKTFWDTIKKNFNNKEILYKTRDKSTGKRIFAVKYGYEDSGSTYKIQGNAILKTTDNNHRIDFVPLNSVSGSEKKLLRVRILKKQNNDDEFTIFGESKIDENFSQDDSIRSQISKARYFIFEEELFNQLIEEANHLLAFNVSVENESKFSINLIDEIIEFEYIEFDETKSPNEQPSNFDKTENSRAELITTYLRLMLTIKYKKNLESKRQPLVVKNSNQYRYQTTPSSLILRPLIGHFKHEQSLKKIRHLIKDLISNVDNSSFKIYKYCNIKKKEYETDSFKRISKPPLSKFKLLIGDSLTIEVVLSSLDYLNQKIHISAHKIEDLFGEGKKKLIDVDFEDLIQVEECLEWIIEEYKNQE |
| Length | 566 |
| Position | Head |
| Organism | Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Wickerhamomyces. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.580 |
| Instability index | 42.70 |
| Isoelectric point | 5.34 |
| Molecular weight | 65544.35 |
| Publications | PubMed=23193139 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP29972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 232.73| 58| 116| 327| 384| 2
---------------------------------------------------------------------------
327- 384 (92.87/45.09) FEEELFNQLIEEANHL.LAFNVSVENESKFSINLIDEIIEFEYIEFDETKSPNEQP.SNF
386- 434 (56.85/25.25) KTENSRAELITTYLRLmLTIKYKKNLESKRQPLVVKNSNQYRYQTTPSS...........
444- 498 (83.01/39.66) FKHE...QSLKKIRHL.IKDLISNVDNSSFKIYKYCNIKKKEY.ETDSFKRISKPPlSKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.09| 19| 29| 246| 264| 5
---------------------------------------------------------------------------
246- 264 (33.35/25.65) SGSTYKIQGNAILKTTDNN
276- 294 (30.74/23.03) SGSEKKLLRVRILKKQNND
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KEILYKTR 2) KKLLRVRIL 3) KRIFAVKYGY | 221 280 234 | 228 288 243 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab