<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29970
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MELPTRWEVELEFVQALANLQYLNFLAQNKYLEDEQFLQYLKYLEYWRKPEYSKYLVYPNCLHILTLLQSEQFRQQILRADVAGVIMNDMVHRWKEPQLTFAPTPLKNEETQNGTANEEQGQSQLPQGQSQSPQAQQPQENQQETQQPPITANSNTTTTTSSTQS |
| Length | 165 |
| Position | Middle |
| Organism | Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Wickerhamomyces.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.872 |
| Instability index | 74.64 |
| Isoelectric point | 4.73 |
| Molecular weight | 19269.18 |
| Publications | PubMed=23193139
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29970
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.03| 18| 18| 110| 127| 2
---------------------------------------------------------------------------
110- 127 (30.54/12.89) ETQNGTANEEQGQSQLPQ
129- 146 (31.49/13.48) QSQSPQAQQPQENQQETQ
---------------------------------------------------------------------------
|