Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLVISQFNTLTTNNQQFKRDDPNQSMSKPISNLSSGPSSTNLYSRVGTPEIPSIKEIRVANLPISKNLNSFEKSLSSLLTSISKYDPQSSDAEDLLGIEHELEKSVEDIISHQQSGLKINSLETKSSKIDSNCKQLLLGLNECRNQLKSLPNLEEVQQEQKSMQRNKIPADELLQYAMKLAKFTTAPPTFDSAAIGPNNFIWPAEDSLRRGMLAIASLNEAELTGKSPIKTQIQDESKLQDEILNGSSPQNVRRGSFGGSYGGDDNGGDDGVIEELDLFDPDDE |
Length | 284 |
Position | Middle |
Organism | Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Wickerhamomyces. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.639 |
Instability index | 54.10 |
Isoelectric point | 4.70 |
Molecular weight | 31246.40 |
Publications | PubMed=23193139 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP29962 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 145.05| 41| 43| 77| 118| 1 --------------------------------------------------------------------------- 37- 72 (31.56/12.98) ..........PSSTNLYSRVGTP....EI.PSIKEIrvanlpISKNLNSFE 77- 118 (61.94/35.07) SLLTSISKYDPQSSDAEDLLGIE...HELeKSVEDI......ISHQQSGLK 121- 164 (51.55/25.12) SLETKSSKID..SNCKQLLLGLNecrNQL.KSLPNL....eeVQQEQKSMQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EILNGSSPQNVRRGSFGGSYGGD 2) NGGDDGVIEELDLFDPDDE | 242 266 | 264 284 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab