| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQAPTTQNEQNIDHSGVPIEALESLRLRLTQVNKCQIGDQVNIIFTQLASLSATLSTYSETLAKTVVYPLPDFPTTEQESLLTTLLRKKALPEVNEWIEDSKKKSTDILLKDDEDLTDWALNLVINQRDEHEFRGFHTKKEIDEQINEDDDIKIKQDFSRPKYSIDEVLKFMYQGSLPTK |
| Length | 180 |
| Position | Head |
| Organism | Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Wickerhamomyces. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.621 |
| Instability index | 42.76 |
| Isoelectric point | 4.74 |
| Molecular weight | 20726.08 |
| Publications | PubMed=23193139 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:EnsemblFungi TBP-class protein binding GO:0017025 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP29959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.96| 14| 34| 103| 116| 1
---------------------------------------------------------------------------
103- 116 (22.44/13.31) KKSTDILLKDDEDL
139- 152 (23.52/14.25) KKEIDEQINEDDDI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ALPEVN 2) YSIDEVLKFMYQGSLPT | 90 163 | 95 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab