<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29955

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNSEVVKQQPPEIPHITTNIISLSDILRKISEFSFAELSHVTQAQPSNEAKKKKLLELIVYLRQEYVRLYVLTKWSKVSAQDFNKLIDLLAWLREQANYFINLIWATKSINQSLLSAKLPNPDLITALEVFTEGRPTLPSHNLIESKLSPTKILETLKDLNVTLSMKFALVEDIPDEFLNYEIKDGRIFIYTEDYEFQVSVIDENSPFFMINFKFNFGDFENSRKILRISNDALKIGGFMELNKILTNYTNTMKLYMIHVKLNGMKNIKHIYHADSFRIVINYWIHSYVFKNSYIEIGLNKDNKIIYRWFKQNEFAETFHDIGYIEDFLNEIYYKHAISILDQIEDLTVNKSVLQINRKTGLFYFKNSTPLSNSFLKKLNSDDFKNINTNLKFLRMDHKFMEVSTILSVTSWIQNDIIKLSPQELSKISEHQQLGTGSESIPYLMKNVKFYTRKEWPSNWFLILLIDTKIKSFIGNIKSITGQWTINTLQELNIESFDYKTSKGLVDYITKSIIIQLITNELGNSIYKVVKGNALVIQTDSFISIPDTANVLYLSFELDPNKKDMLLKLKGRLKSNITLEDFAIDKDGVFEIFETVEYKRLSILGNIIAKLEKLAKVIGLIKFLKLESLNLLKVKLDEVVFKYGSQICTLKDGFNIELPATNPHNICLGSIKRYLNSRGIGKLFKYLQDSNILVEKLNELAKASKTDTTYDPSKLRYQVIPKNLNFFTVLYYNNSKPERQVLELNIEMKNKNGNNYYYISFDRDTDAELKVDFTNKGQLAKLANGQNKLLLLQNGILCDEEGLNKILGYFHEKIINKKSAIFGRHEDVKRNVLELTDIKDQILLQRVDSIIINKSIFTMPVEDNDGQIVLTHPSDPSTQVSILNFGANVLSWKIKGEEQLWLSEGAKLDGSKAVRGGIPLVFPVFGKKDEGPTANLPQHGFARNSTWEFLGQTKENPPTVQFGLGPENVDEELLSKWPNNDFTLIYTIELTEESLKTSIEVTNNDQHPWEFNWLFHTYLKINDIEDVLVSNFPGELCYDQLLKQSYEEKLPVVNFNEEVDRIYQKVPEDKITQVVALGYPVHTLKRSGLPDIVVWNPWINKSESIGDFLPKSGYKNMVCIEPGYVHEFKTLQPGETWNASQLLYKDELKFQAV
Length1153
PositionTail
OrganismWickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) (Yeast) (Pichia ciferrii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Wickerhamomyces.
Aromaticity0.11
Grand average of hydropathy-0.270
Instability index35.37
Isoelectric point6.36
Molecular weight133095.39
Publications
PubMed=23193139

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
carbohydrate binding	GO:0030246	IEA:InterPro
glucose-6-phosphate 1-epimerase activity	GO:0047938	IEA:UniProtKB-EC
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
carbohydrate metabolic process	GO:0005975	IEA:InterPro
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29955
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     120.08|      24|      24|     284|     307|       1
---------------------------------------------------------------------------
  284-  302 (26.78/11.70)	.............WIHSYVFKNSYIEIGLNKD
  303-  327 (34.62/17.16)	NKIIY.......rWFKQNEFAETFHDIGYIED
  330-  359 (24.13/ 9.85)	NEIYYkhaisildQIEDLTVNKSVLQI..NRK
  360-  382 (34.55/17.11)	TGLFY........FKNSTPLSNSFLK.KLNSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.75|      22|      23|     938|     959|       2
---------------------------------------------------------------------------
  938-  959 (41.65/26.07)	QHGFA.RNSTWEFLGQTKENPPT
  961-  983 (34.09/19.91)	QFGLGpENVDEELLSKWPNNDFT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.78|      19|      23|     710|     732|       3
---------------------------------------------------------------------------
  712-  732 (32.03/26.49)	PSKLRYQVIP.....KNLNFFTvlYY
  734-  757 (29.75/11.67)	NSKPERQVLElniemKNKNGNN..YY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.69|      14|      23|    1084|    1097|       5
---------------------------------------------------------------------------
 1084- 1097 (26.51/20.11)	LKRSGLPDIVVWNP
 1109- 1122 (27.18/20.83)	LPKSGYKNMVCIEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.23|      20|      23|     454|     473|       6
---------------------------------------------------------------------------
  454-  473 (36.61/19.06)	KEWPSNWFLILLIDTKIKSF
  478-  497 (34.62/17.66)	KSITGQWTINTLQELNIESF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.21|      29|      34|      48|      81|       7
---------------------------------------------------------------------------
   48-   81 (42.82/36.61)	NeakkkKLLELIVYLRQE...YVRLYVLTK...WSKVSAQ
   84-  118 (38.38/22.41)	N.....KLIDLLAWLREQanyFINLIWATKsinQSLLSAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.58|      23|      24|     154|     177|       8
---------------------------------------------------------------------------
  128-  152 (32.81/20.89)	LE.VFTEGRPTLP.SHNLIES....klSPTK
  154-  177 (32.51/26.49)	LE.TLKDLNVTLSmKFALVED......IPDE
  179-  204 (20.26/ 9.83)	LNyEIKDGRI.....FIYTEDyefqvsVIDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.37|      24|     252|     561|     590|       9
---------------------------------------------------------------------------
  561-  584 (38.56/17.18)	NKK.....DMLLKLKGRLKSN........ITLED.FAI
  598-  623 (20.96/12.06)	YKRlsilgNIIAKL.EKLAKV........IGLIK.F..
  625-  656 (20.84/ 6.62)	.KL.....ESLNLLKVKLDEVvfkygsqiCTLKDgFNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.75|      16|      17|     212|     227|      11
---------------------------------------------------------------------------
  212-  227 (27.47/13.93)	NFKFNFGDFENSRKIL
  231-  246 (27.97/14.31)	NDALKIGGFMELNKIL
  397-  407 (18.31/ 6.87)	DHK.....FMEVSTIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.72|      32|      34|     804|     836|      13
---------------------------------------------------------------------------
  804-  836 (49.53/33.58)	NKILGYFHEKIINKKSAIFGRHEDVKRNVLeLT
  840-  871 (53.18/31.85)	DQILLQRVDSIIINKSIFTMPVEDNDGQIV.LT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.61|      18|      18|     893|     910|      14
---------------------------------------------------------------------------
  893-  910 (30.74/16.67)	K.IKGEEQLWLS.EGAKLDG
  912-  931 (22.87/10.63)	KaVRGGIPLVFPvFGKKDEG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29955 with Med14 domain of Kingdom Fungi
Unable to open file!