<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29949

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMQQQFQAVVQQQQQLQQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRMAQLQLQQQQQQQQQALQAQPPLQQPPMQQPQPPPSQALPQQLQPMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRAPMVVQQQQVQPQVQPVQPQVQPQAAVPTAQASQIVGSGVQVSQNSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEDDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length553
PositionTail
OrganismCanis lupus familiaris (Dog) (Canis familiaris)
KingdomMetazoa
Lineage
Aromaticity0.03
Grand average of hydropathy-0.736
Instability index95.48
Isoelectric point9.21
Molecular weight61428.22
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.26|      20|      20|     101|     120|       1
---------------------------------------------------------------------------
   71-   90 (35.36/ 6.18)	QP........PMQQPQPPPSQALPQQLQ
   91-  118 (36.90/ 6.87)	PMhhpqhhqpPPQPQQPPVAQNQPSQLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.38|      22|      36|       2|      26|       3
---------------------------------------------------------------------------
   20-   37 (27.56/ 7.07)	QQQQQHL.......IKlHHQNQQQI
   38-   56 (31.64/ 9.28)	QQQQQQLQRmAQL......QLQQQQ
  140-  162 (30.18/ 8.72)	AQPQLKLVR.APMvVQ.QQQVQPQV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.02|      22|      45|     223|     244|       4
---------------------------------------------------------------------------
  164-  182 (30.70/ 8.04)	PVQPQVQPQAAV...PTAQASQ
  223-  244 (42.49/14.56)	PGQPSSQPNSNVSSGPAPSPSS
  271-  290 (32.82/ 9.21)	PG.PLNTP.VNPSSVMSPAGSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.81|      17|     117|       2|      18|       6
---------------------------------------------------------------------------
    2-   18 (31.72/ 9.77)	QQQFQAVVQQQQQLQQQ
  120-  136 (30.10/ 8.89)	QSQTQPLVSQAPALPGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      56.70|      14|     117|     332|     345|       8
---------------------------------------------------------------------------
  298-  311 (22.52/16.59)	LDKLKQLSKYI....EPL
  318-  334 (14.75/ 8.13)	IDKNEDRKKD.lskmKSL
  335-  350 (19.44/13.24)	LDILTDPSKRC..plKTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.14|      17|      47|     420|     440|       9
---------------------------------------------------------------------------
  420-  440 (25.55/31.82)	TAPVVCtrkrRFEDDERQSIP
  468-  484 (30.59/23.85)	TVHLIC....KLDDKDLPSVP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29949 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QQQQQQHLIKLHHQNQQQIQQQQQQLQRMAQLQLQQQQQQQQQALQAQPPLQQPPMQQPQPPPSQALPQQLQPMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRAPMVVQQQQVQPQVQPVQPQVQPQAAVPTAQASQIVGSGVQVSQNSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
19
303










Molecular Recognition Features






MoRF SequenceStartStop




NANANA