<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29946
Description |
Cyclin C |
Sequence | HLCSCSLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMCVADVTL |
Length | 148 |
Position | Kinase |
Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | 0.120 |
Instability index | 42.62 |
Isoelectric point | 8.29 |
Molecular weight | 17362.18 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29946
No repeats found
|