<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29925
| Description |
Uncharacterized protein |
| Sequence | MSVEKDIIKIQNKLQSMSDENADQTQALDLLKALKDLPITLDILTKTRVGMTVNSFRKSCKDEEVITFSKALIKNWKKLLSGDKSVPQEPKKDKKERKKSEEREQKIDAKKDTPKPVVFPTPSTTDAIRLKCRDLLITALKTEDEFGGCASVEELADELEDAIYSEFKNTDARYKNRVRSRYSNLRDAKNPQLRSNFIAGAITPAQLAKMTAEEMASNEMKTLRNKLIKESIDDAQLATVQGTSTDLLKCGKCKKRNCTYNQIQTRSADEPMTTFVMCNECGNRWKFC |
| Length | 288 |
| Position | Unknown |
| Organism | Acyrthosiphon pisum (Pea aphid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha>
Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.733 |
| Instability index | 41.35 |
| Isoelectric point | 8.98 |
| Molecular weight | 32691.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29925
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.65| 16| 27| 193| 218| 1
---------------------------------------------------------------------------
193- 208 (27.85/42.41) LRSNFIAGAITPAQLA
223- 238 (26.79/12.75) LRNKLIKESIDDAQLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.54| 12| 26| 245| 256| 5
---------------------------------------------------------------------------
245- 256 (22.37/15.48) TDLLKCGKCKKR
273- 284 (24.17/17.29) TTFVMCNECGNR
---------------------------------------------------------------------------
|