<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29924

Description Mediator of RNA polymerase II transcription subunit 1
SequenceMNAATQSAVLLHNGISEDKSRKLQMQLMMEKLRSKALQSQYKPLTDSIKNIKLALLEKRINVDPNEKCLVQKSLDLLQQNIKVTTLQTMIERLDSVSRHLGLKFTVGPSGKDIFVSSDMFYLEIILEDNGGVKDVKIHHDGKSEPQSCADLIKSLANCDFADFTSQLEGLASIYQLNADKMVKCRAFNALQTLEADLETFAQVHYTYHKDLISMVHKTPLGVVKPRRGGHPMKIIFFVSPYDLLDVENNTMMNLDKETLDVGCYATVCIEAATTTNVQSTSLLSASRSSTGINTPIFVPFTVQNSITLPAVFVLRLNEPMPICLQLAENIKSVIEMDLEMSAPRSLLGMIIEPSSQPLSVTLPDQQHCYFLTDSNLKGVFIQNIKFTHPSQVTRIIAYLRQQALFNCLIRSCVRPECQQEMFNTTVFEIAAYEEMSWQHLVVSFEHPIEESLATAEFDLSDISRLQCQVYTSSSETNGESVLTSPEFASRVLQRCFSIPITMRSLIQTWERENQQSLETNIKNNLSGTGGSNNLGDSSDLNQHFADPSAGPDFPSDLDVKLEPLDGASSLDCFPASMIQRDLDQYISDPSFLPDIDFNQFPMDVDQEEQKEQSSFRDASLQEDPPDPKNSPTKTEELISILADDNGKGEDEKPPPDTGQVIIETSSDDSVEKSSSTVSGEFDTINEDVEQSSQSLFEIDDDGPDLHDLNDVKEFIKMTAKDVALVSMKDEDKKDITSDKIHQSPSVSITAVDLSSIPSPQILPQVTVDRRPNIEVIPIPNVPSSITITPISAKTIAEEKSKKSKKDIEGKIEKKRKRKLETETNVPEKLKKHSGSLKMSDSSRSSSPSDYASNQLPSSTMMMKLGTAQKLKQSTSPTLSISSVSLPNSNKYTVTSPKSNSGKPSLSALKMSVHSPKSESKQKSKEFSKDKEKRSYASSNSSLSQSPKSSKSSSKKSDIEDLGTPIPPDSNKAQMKCRKLSAVIDRLSKDKTAQHYSVDSEVPKNKESTPKAFDKGIALNTNINMKNPDSYQVKHSSDGMKITINKTRTKESKQKSSVAGSPKPGPKSGSFSGLNSKKTTYSIPKPGPSSSQSKQSFSVPKNKSNLTVTKVKSGSGKIRSEKSIFARAEMRKSSPTSKDEESLKVVNPVESIIKHKLDTSKFQIPKLSARANADEKRCTETKADTSKPMDLAKKSDVDKKYNQGDYICQKKSTTERLNSLPGITVTTVEERLKPKESALSSLKIDLPLISFHTPKADTTVEMSECKDYSQKKEEIPNNSVYQPKPVTPVTTYATTPSVSVHILKSPVPSPLLVPSPHSASPSITDEELIDDAFVRVGK
Length1337
PositionMiddle
OrganismAcyrthosiphon pisum (Pea aphid)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha> Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon.
Aromaticity0.05
Grand average of hydropathy-0.562
Instability index55.33
Isoelectric point6.50
Molecular weight147620.44
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29924
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     259.62|      44|      52|     884|     927|       1
---------------------------------------------------------------------------
  834-  878 (41.45/18.54)	GSLK.....MS.D.SSRS..SS...PSDYA.......snQL.PSSTmmmKLGTA.QKL...KQSTSPTL
  879-  905 (23.24/ 6.38)	.............................S.....issvSL.PNSN...KYTVT.SPK...SNSGKPSL
  906-  958 (55.32/27.80)	SALK.....MSVH.SPKS..ESKQKSKEFS...kdkekrSY.ASSN...SSLSQ.SPKsskSSSKKSDI
  959-  986 (28.61/ 9.97)	EDLG.....TPI.............................pPDSN...KAQMK.CRK...LSAVIDRL
  987- 1036 (40.31/17.78)	SKDK.....TAQHySVDS..EV.PKNKE.StpkafdkgiAL..NTN....INMK.NPD...SYQVKHSS
 1037- 1070 (35.46/14.54)	DGMK.....ITIN.KTR.tkESKQKSS.........................VAgSPK...PGPKSGSF
 1071- 1116 (35.24/14.40)	SGLNskkttYSIP.KPGP..SSSQSKQSFS...vpknksNL..........TVT.KVK...SGSGK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     223.59|      52|      52|     648|     699|       2
---------------------------------------------------------------------------
  501-  547 (34.13/15.76)	.........TMRSLIQ....TwerEN.............QQSLETNiKNNLSGTGGSNNlGDS...SDL.NQH.FA...DP
  550-  621 (46.26/24.51)	GPDF..PSDL.DVKLEpldgA...SSldcfpasmiqrdlDQYISDP.SFLPDIDFNQFP.MDVdqeEQK.EQSSFRdasLQ
  648-  699 (84.43/52.04)	GEDEKPPPDTGQVIIE....T...SS.............DDSVEKS.SSTVSGEFDTIN.EDV...EQS.SQSLFE...ID
  702-  752 (58.77/33.53)	GPDLHDLNDVKEFIKM....T...AK.............D..VALV.SMKDEDKKDITS.DKI...HQSpSVSITA...VD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.65|      36|      43|     323|     358|       3
---------------------------------------------------------------------------
  323-  358 (60.35/43.64)	CLQLAE.NIKSVIEMDLEMSAPRSLLGMIIEPSSQPL
  368-  404 (55.30/39.30)	CYFLTDsNLKGVFIQNIKFTHPSQVTRIIAYLRQQAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.15|      18|      23|    1155|    1175|       4
---------------------------------------------------------------------------
 1155- 1175 (25.57/21.27)	KLDTSKfqiP.KLSARANADEK
 1181- 1199 (26.57/13.42)	KADTSK...PmDLAKKSDVDKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.47|      12|      23|     756|     767|       6
---------------------------------------------------------------------------
  756-  767 (21.78/11.33)	IPSPQILPQVTV
  776-  787 (21.69/11.26)	IPIPNVPSSITI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.87|      24|     131|    1128|    1151|       7
---------------------------------------------------------------------------
 1123- 1150 (33.53/16.35)	I.....faraEMRKSSPTSKDEESLKVVNPVES
 1229- 1249 (22.99/ 8.79)	............ERLKPKESALSSLKIDLPLIS
 1250- 1278 (23.35/ 9.05)	FhtpkadttvEMSECKDYSQKKEEI....PNNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.69|      16|      22|    1282|    1297|       8
---------------------------------------------------------------------------
 1282- 1297 (28.65/12.70)	PKPVTPVTTYATTPSV
 1307- 1322 (29.04/12.97)	PSPLLVPSPHSASPSI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29924 with Med1 domain of Kingdom Metazoa
Unable to open file!