Description | Uncharacterized protein |
Sequence | MSTSMSVTKSYTNRLKSDVKCMLENFEGIVKLCKTEDDQTQISKATRSELIAFEMEVRAANIVRAGESLLKLVSDMKQYLILNDFPSVNEAIAQNSKLFRTKQVECDRKLTSLVDDMSTELYELEEEYYTSNYK |
Length | 134 |
Position | Head |
Organism | Acyrthosiphon pisum (Pea aphid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha> Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.451 |
Instability index | 38.95 |
Isoelectric point | 4.99 |
Molecular weight | 15419.41 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29923 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 103.15| 32| 38| 49| 80| 1 --------------------------------------------------------------------------- 49- 80 (50.85/36.68) ELIAFEMEVRAANIVRAGESLLKLVSDMKQYL 90- 121 (52.30/37.90) EAIAQNSKLFRTKQVECDRKLTSLVDDMSTEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DFPSV 2) KLFRTK | 84 97 | 88 102 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab