<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29921
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSGFPSSYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPCESELTGSVNLMAYYGLEHTYSKFSGKRLKESLSSFLPNLPGIIDTPGHNDQSSLRSVIEKPPIGGKEILPLTTHQLAGFRLHPGPLPEQYRYANQPPTKKHKNKHKKSKYKSGEALSLDMAANELGLGDIHEKKHKKQKRHDDDKERKKRKKEKKKKKQKHSPEHPGNITPGQHSN |
| Length | 233 |
| Position | Head |
| Organism | Acyrthosiphon pisum (Pea aphid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha>
Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.116 |
| Instability index | 61.03 |
| Isoelectric point | 9.94 |
| Molecular weight | 26000.31 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29921
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 242.77| 77| 85| 6| 89| 1
---------------------------------------------------------------------------
6- 85 (124.33/72.66) SSYSPkSSPRGARSPVVSRQDSTGTL..KTTISlGKN..PSIVHS.GPFYLMKEP.PCESELTGSVNLMAYYGlEHTYSKF.SGKRL
90- 173 (118.45/53.70) SSFLP.NLPGIIDTPGHNDQSSLRSVieKPPIG.GKEilPLTTHQlAGFRLHPGPlPEQYRYANQPPTKKHKN.KHKKSKYkSGEAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.69| 12| 18| 189| 201| 2
---------------------------------------------------------------------------
189- 201 (19.07/13.58) EKKHKKQKrHDDD
210- 221 (22.62/11.42) EKKKKKQK.HSPE
---------------------------------------------------------------------------
|