| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEQNIEHTCFRDEFFLSANILTSKNVLSYFSASQFYDQSCLNEVIKMQTKYTGNEITDDEIDEKLKEMVGVQYILAKSLDEDQLFIIYKIDRFTRVEYDVLQIYYVLNGNIYQSPTNHALLSSRLSNSLYFINEAIDMLGKRRDFDCFKGFSYSKTEYPTSTNGNNTDENMFFYKVLQDYLTKTAKEREKSE |
| Length | 192 |
| Position | Head |
| Organism | Edhazardia aedis (strain USNM 41457) (Microsporidian parasite) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Edhazardia. |
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.535 |
| Instability index | 45.42 |
| Isoelectric point | 4.83 |
| Molecular weight | 22629.11 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP29912
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 137.75| 43| 44| 74| 117| 1
---------------------------------------------------------------------------
74- 117 (67.93/42.08) ILAKSLDEDQLFIIYKIDRF.TRVEYDVLQIyYVLNGNIYQSPTN
120- 163 (69.83/38.83) LLSSRLSNSLYFINEAIDMLgKRRDFDCFKG.FSYSKTEYPTSTN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ENMFFYKVLQDYLTKTAKEREKSE 2) KTEYPT | 169 155 | 192 160 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab