<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29907

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMSDEQGINLALDPNLITLPLNGSTGTTTTSPLEMDTAAGTDTTAKPKVSLVDNPHEMYGQMPLAQLVPLILQQRQIPFSQLLEQNIINSMSGDEQPFIPEEQTVDMAESGALNNRRGQDETFASIRANMVEQTNVALNEASLALETVALLLSATRESNAKASISPFLKNTVPLRSLNSDSVLQQPSEPLDDLKFALGWKLKCLDDCKNKLRREVDTLRATLEREHLYWRKIGQYIKNSDVVFKMRDKSTGLKAIALKFGYEDSGSAYRYDRGIAILRNRPESDMLELVPVASTRDGPRGFQEKLLRVRIFTKIASEEDYIFSGESTLQDNAEGSVFNNENIRGQISKLKDIIFEKELMYQLKRECAPLISYGVSIENENKVVMELPNEKFEIELVSCDESSMANHDHDNPRTNDRRANLFLITLRMLLIVQFKKNIRRGLAMNVSSSRRGPEDILLLRPLLAKLRHQNYKILLRMIIKDNFLEMVQGSTVEEQDNTPRDDAGTNSARVLDRHIYKLNSEIDAFNQLINYPSTLFTLKTATGEALTVSLELPNYCNAKIEVSYTSFHAKFSEFKEAEEFLHFLVNEYVNKSQPPLNQGGEDPPLSVTSR
Length608
PositionHead
OrganismKazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania.
Aromaticity0.07
Grand average of hydropathy-0.428
Instability index45.62
Isoelectric point5.34
Molecular weight68662.19
Publications
PubMed=22123960

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364140
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
activating transcription factor binding	GO:0033613	IEA:EnsemblFungi
RNA polymerase II complex recruiting activity	GO:0001139	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP29907
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      95.83|      25|      36|     333|     357|       1
---------------------------------------------------------------------------
  300-  325 (18.62/ 9.08)	...FQEKLLRVRIfTKIaseEDYIFSGES
  333-  357 (41.94/29.35)	GSVFNNENIRGQI.SKL...KDIIFEKEL
  372-  394 (35.27/23.55)	GVSIENEN..KVV.MEL...PNEKFEIEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.25|      14|      31|     415|     428|       2
---------------------------------------------------------------------------
  415-  428 (23.58/11.87)	RRANLFLITLRMLL
  448-  461 (24.67/12.70)	RRGPEDILLLRPLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.79|      11|      23|      87|      97|       4
---------------------------------------------------------------------------
   87-   97 (20.27/13.00)	INSMSGDEQPF
  112-  122 (19.52/12.25)	LNNRRGQDETF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29907 with Med17 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LPLNGSTGTTTTSPLEMDTAAGTDTTAKPKVSLVDNPH
2) SMSGDEQPFIPEEQTVDMAESGALNNRRGQ
18
89
55
118










Molecular Recognition Features






MoRF SequenceStartStop




NANANA