<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29906
| Description |
Uncharacterized protein |
| Sequence | MADRLTQLQVCLDQLMEQFCAALNYVDKSHGFSPLGPGEPVVADKHAPPLPPQEEFLGTVDELSGDIILKTRQLMKLIDSLPGVDVSEAEQLRRIDSLQQQLVATEQRKINVVREKDQLLRDVDQLISMFVAGIADSRQQS |
| Length | 141 |
| Position | Middle |
| Organism | Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.249 |
| Instability index | 51.22 |
| Isoelectric point | 4.66 |
| Molecular weight | 15737.82 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29906
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.67| 15| 15| 60| 74| 1
---------------------------------------------------------------------------
60- 74 (24.08/13.23) VDELSGDIILKTRQL
78- 92 (24.59/13.62) IDSLPGVDVSEAEQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.63| 12| 26| 93| 104| 2
---------------------------------------------------------------------------
93- 104 (19.97/10.57) RRIDSLQQQLVA
121- 132 (20.66/11.13) RDVDQLISMFVA
---------------------------------------------------------------------------
|