<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29901
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDIPLDELQWKSPEWIQAFGLRTDNVLDYFSESPFFDKTSNNHVIKMQRQFSQLPVDGMPQPQGPGGTAPDGSKSATLGDSQEFSHLDPLRREVLGKYPLYMTMERELCKLRGVEYVLACVREPDFWVVKKQRRLSPRRTEPMQDYYIIGANVYQSPSMFKILQNRMMSASYHLSNTLNDLQKLVHFQPSQGVQFKTQSTATDGAVQGATQGAATTTPMPGTAPNTALGPLSAVPTTAAGSAQTAGNTSPYENGTRELISKEMMDKLMATSIRSQPECIQ |
| Length | 280 |
| Position | Head |
| Organism | Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.523 |
| Instability index | 54.12 |
| Isoelectric point | 6.44 |
| Molecular weight | 31118.93 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29901
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.54| 15| 17| 123| 137| 1
---------------------------------------------------------------------------
123- 137 (28.64/20.47) EP..DFWVVKKQRRLSP
141- 157 (23.90/16.03) EPmqDYYIIGANVYQSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.87| 23| 131| 55| 79| 2
---------------------------------------------------------------------------
57- 79 (45.96/26.84) DGMPQ..PQGPGGTAP.DGSKSAT.LG
203- 229 (29.91/10.24) DGAVQgaTQGAATTTPmPGTAPNTaLG
---------------------------------------------------------------------------
|