<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29898
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAEEPASNDISSLYPPPPPYIKFFTKENLDRLPSYLEKKRSQEQGGYGNDAEHVTSELDFLIPPPMPADDQYRAFGSTWQVKDKLPDLEAMGMTQLYQKTQPGQGPSPEGEATNYQYKIKELKRLLQSLLLNYLELVGILSINPELYEPKVENIRTVLVNIHHLLNEYRPHQSRESLIMLLEEQLEYKKGEIKTVEATCQQVRQKLAEIEKSLT |
Length | 214 |
Position | Middle |
Organism | Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.678 |
Instability index | 48.47 |
Isoelectric point | 5.16 |
Molecular weight | 24634.74 |
Publications | PubMed=22123960
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP29898
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.22| 33| 50| 4| 37| 1
---------------------------------------------------------------------------
4- 37 (58.52/32.06) EPASNDISSLYPPPPP....YIKF.FTKENLDRLPSyLE
52- 89 (53.70/25.31) EHVTSELDFLIPPPMPaddqYRAFgSTWQVKDKLPD.LE
---------------------------------------------------------------------------
|