<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29895

Description Mediator of RNA polymerase II transcription subunit 20
SequenceMVLNSVIFADKATPATLTEFQDRLLNNYLLQQGDPWSLDFKTYRSQVTNIDAVDPSISKLLYSITFSRRDTVLIKNGTAVLSRHGDGDGDRDGADGDTEAWFPGPVDSLLDGKLSNIWTQRQSIKGDLGQTFHSRTVGTGGPQSGDRLTVRCCNLFSQTGFKGLAIELSGAVLARHTDDIVALLAEVQVTHXXXXXDCLQTPAGVDKTRRANHVLCNLAFQYVSALE
Length227
PositionHead
OrganismKazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania.
Aromaticity0.07
Grand average of hydropathy-0.228
Instability index29.73
Isoelectric point5.50
Molecular weight24227.89
Publications
PubMed=22123960

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
	RuleBase:RU364152
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
protein domain specific binding	GO:0019904	IEA:EnsemblFungi
TFIID-class transcription factor complex binding	GO:0001094	IEA:EnsemblFungi
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi
GO - Biological Process
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus	GO:0010689	IEA:EnsemblFungi
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels	GO:0010691	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly	GO:0051123	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP29895
No repeats found




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP29895 with Med20 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA