<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29893
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MVQQLSLFGVIDDESYDLFVSTMTMSYGSSPIIFANLDTMWKPDPAFEIGETNSKNQLVEKNRIKMSQVLPLDLLSKDSTGEKTVDSTLLKELQTDELPIPLKIVQHMINNNSSDETDPTKSTGNSGTGFGTWTMSISDIPAAGSNRKVCMQSITESVLIDSIGPNASTQSFMKQLCYVLDYLYVSIGIRFHLKHGLVVELQKVWDMNSGKQITKGGFLIKAYTNIKRATDIDRLNYSEQILLNLQKELQGYLDLVMADRKSMNSKMGLDNESL |
| Length | 274 |
| Position | Head |
| Organism | Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Kazachstania.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.250 |
| Instability index | 33.69 |
| Isoelectric point | 5.06 |
| Molecular weight | 30599.66 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
termination of RNA polymerase II transcription GO:0006369 IEA:EnsemblFungi
transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29893
No repeats found
|