<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29886

Description Uncharacterized protein
SequenceMAKIEREEGKRGKEGTVFWVIILIWCCFVISHSRIGENSSIWLKLVSPPKKKSITVMSGSYWTSTQRLKWQHSKASLARERQKLWILESQLFPQGLSIVMTTKSKDAQGTVLTTTKNIPIMHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQITLATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRNLVTEARSLWPEFVPPDPTKVTEFEFYLIEELQSYLIVHNPYKSMLQITKVLKEPPYNINFFNEDIQNCWSLINDSYINDVHLIYPPHIIAMACMFITVSIQNGKSVDSLKQQDASAELTPTQESFNRFIAESQVDLEELMDTIQQQITLYDHWDKYHEPWIKFLLHTLYLQPQAATPKLGNNSATPSSGNSVTGSTTPSLANPMHQGTVSNGPTVSGVTANGNLKAGT
Length427
PositionKinase
OrganismKazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC 10181 / NCYC 3082) (Yeast) (Saccharomyces naganishii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kazachstania.
Aromaticity0.10
Grand average of hydropathy-0.208
Instability index47.83
Isoelectric point8.61
Molecular weight48875.79
Publications
PubMed=22123960

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi

GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by galactose	GO:0000411	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle	GO:0010673	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.76|      17|      22|     141|     162|       1
---------------------------------------------------------------------------
  149-  168 (22.05/18.04)	NIRQITLATAHIYLsrfLLK
  173-  189 (28.71/ 9.16)	EVNLYLLVTTCVYL...ACK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29886 with CycC domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TPKLGNNSATPSSGNSVTGSTTPSLANPMHQGTVSNGPTVSGVTANGNLKAGT
375
427










Molecular Recognition Features






MoRF SequenceStartStop




NANANA