| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MNGNNKNGEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRLYKLNVRSNDPQSGLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFPELQKPVEDIIKRTSPTDEISNTH |
| Length | 157 |
| Position | Middle |
| Organism | Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Saccharomyces. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.764 |
| Instability index | 50.21 |
| Isoelectric point | 4.99 |
| Molecular weight | 17890.76 |
| Publications | PubMed=12775844 PubMed=22384314 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP29874 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DRLYKLNVR 2) KVDIPLEVVQYI | 58 76 | 66 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab