<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29870
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MALGLDDDELKSVEQILSRLAQLSSSIQSLKMDILKSNPLPHPDSLHASARILQRNLSTVLDCLSENAELFSRVAVRPSTNYPGRAQENVLTQLLRKKLEPDVEELVEVGRETARRATPEGVAELQAIWDELRAWTQSRIAEYVRDEAGDVYTKEERDMGVEKVRTGLRREIEEDDEDEEDDEDEDEDEDEDEDEDKDGRDGATAAAAAAAAGVNEVAALPPRGPEIETLLWFMTRADFDVPRNIEYERKGAVLMRGLEGINIPPERTDSGQPGASATQPMQL |
| Length | 283 |
| Position | Head |
| Organism | Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus) (Tritirachium shiotae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.712 |
| Instability index | 54.31 |
| Isoelectric point | 4.34 |
| Molecular weight | 31538.41 |
| Publications | PubMed=22761991
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29870
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.52| 14| 15| 118| 131| 1
---------------------------------------------------------------------------
101- 112 (15.05/ 6.71) .PD.VEELVEVGRE
118- 131 (25.53/15.94) TPEGVAELQAIWDE
136- 147 (19.93/11.01) TQSRIAEY..VRDE
---------------------------------------------------------------------------
|