<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29843
| Description |
Uncharacterized protein |
| Sequence | MLEEGPMATLMNDPMRLYRARRDAERKRVTEKYLIEGFISSGTYGRVYKAKSRDSDGRIHAIKKFKPDKEGDIITYTGISQSAIREIALNREISHENVVALKEVILEDKSIYMVFEYAEHDFLQVIHHHSQTLRTGITLPVLKSLTYQLLNGLLYLHTVHIIHRDLKPANILITASGVVKIGDLGLARLTHQPLQPLFAGDKVVVTIWYRAPELLLGAKHYNKAVDVWAVGCVMAELASLRPIFKGEEAKLDSKKNVPFQKDQLLKIFEVLGTPDEREWPGVKTLPEYQNMKRLDVYKNHLLDWFQSRTRSTEGYELLRLLFAYDPDNRLTAKEALQNKWFHEDPKPTANAFQSLPPHQIPPQRRISHDDAPSMIPLPAASQSQAQSQVQAQIAQVQAQAQAHLSAQLSHSHSGKPGSAASFASLSGGATGIGSGHARKKARIG |
| Length | 444 |
| Position | Kinase |
| Organism | Fibroporia radiculosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporales incertae sedis> Fibroporia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.376 |
| Instability index | 37.54 |
| Isoelectric point | 9.34 |
| Molecular weight | 49833.55 |
| Publications | PubMed=22247176
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.14| 16| 16| 322| 337| 1
---------------------------------------------------------------------------
322- 337 (27.87/19.76) FAYDPDNRLTAKEALQ
341- 353 (24.83/16.78) FHEDPKP..TA.NAFQ
358- 371 (19.44/11.50) HQIPPQRRISHDDA..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.16| 15| 34| 255| 269| 2
---------------------------------------------------------------------------
255- 269 (25.74/14.41) KNVPFQKDQLLKIFE
292- 306 (27.41/15.73) KRLDVYKNHLLDWFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.09| 10| 29| 16| 25| 3
---------------------------------------------------------------------------
16- 25 (18.25/13.36) RLYRAR.RDAE
46- 56 (13.83/ 8.40) RVYKAKsRDSD
---------------------------------------------------------------------------
|