<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29839
| Description |
Uncharacterized protein |
| Sequence | MSDGPQTDVSRPSALPTAKLLQRSTIPLVDQNSNEYLDAIEEEWNKKVDVEIDTLVEGMVDLVGIASISDKDKFRIAQESYQAECRAESMIRAAHSLLSIIHSMKLLLLLSDESQIANRRDMEMRHVQTEKEDLQQRVSALLNDLLHPPKSDTSMDTS |
| Length | 158 |
| Position | Head |
| Organism | Fibroporia radiculosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporales incertae sedis> Fibroporia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.454 |
| Instability index | 43.70 |
| Isoelectric point | 4.72 |
| Molecular weight | 17791.91 |
| Publications | PubMed=22247176
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29839
No repeats found
No repeats found
|