| Description | Mediator of RNA polymerase II transcription subunit 24 (Fragment) |
| Sequence | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGP |
| Length | 54 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.133 |
| Instability index | 31.68 |
| Isoelectric point | 9.22 |
| Molecular weight | 6321.40 |
| Publications | PubMed=16625196 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP29829 No repeats found No repeats found |
| Disease |
| MoRF Sequence | Start | Stop |
| 1) DYQWAIN 2) ILQAWKER 3) KVVNL | 20 10 2 | 26 17 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab