<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29828

Description Mediator of RNA polymerase II transcription subunit 13 (Fragment)
SequenceXVQKWVKFSSVSDGFNSDSTSHHGGKIPRKLANHVVDRVWQECNMNRAQNKRKYSASSGGLCEEATAAKVASWDFVEATQRTNCSCLRHKNLKSRNAGQQGQAPSLGQQQQILPKHKTNEKQEKSEKPQKRPLTPFHHRVSVSDDVGMDADSASQRLVISAPDSQVRFSNIRTNDVAKTPQMHGTEMANSPQPPPLSPHPCDVVDEGVTKTPSTPQSQHFYQMPTPDPLVPSKPMEDRIDSLSQSFPPQYQEAVEPTVYVGTAVNLEEDEANIAWKYYKFPKKKDVEFLPPQLPSDKFKDDPVGPFGQESVTSVTEYVFFLIVTIII
Length327
PositionMiddle
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.07
Grand average of hydropathy-0.760
Instability index55.57
Isoelectric point7.26
Molecular weight36427.40
Publications
PubMed=16625196
PubMed=18691976
PubMed=18669648
PubMed=19369195
PubMed=23186163

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP29828
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     124.78|      32|      34|     179|     212|       1
---------------------------------------------------------------------------
  123-  149 (31.06/13.26)	........EKSEKPQK.RPLTPfhHRVSVSDD..VGMD
  179-  212 (59.32/37.44)	TPQ.MHGTEMANSPQP.PPLSP..HPCDVVDEgvTKTP
  214-  240 (34.40/14.93)	TPQsQHFYQMP.TPDPlVPSKP..ME.DRID.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.86|      18|      45|       3|      20|       2
---------------------------------------------------------------------------
    3-   20 (32.39/18.36)	QKWVKFSSVSDGFNSDST
   49-   66 (31.47/17.69)	QNKRKYSASSGGLCEEAT
---------------------------------------------------------------------------


Associated diseases

Disease
breast cancer	PMID:26452386


Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP29828 with Med13 domain of Kingdom Metazoa

Unable to open file!