<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29823
| Description |
Uncharacterized protein |
| Sequence | MSQHQNVYAPAPWAPRQANPDEDWTKISDLAERRRIQNRIAQRNYRKKLKRRLEDLERRACTSDGNSSGNGKPTSSNGSSANASNGGSSSSSGSKKQQQQQQQRQQQQQQQQHQQQTQAAAPLTPPELFPAHAYPPPEDMMMAPCGTSPPHAQALAYAEYLVSTTMPVTFPDMAHFDDSIVGDLDHSEVAPYTNCRYMPGMDVSNPAPYDHSNSHMNSSWHQSHFYPVLHPPPYLFLPHLQTSFASSQSPTPPPLGGFSNVQKTSRKLQQILGLEQHLPTNVN |
| Length | 283 |
| Position | Tail |
| Organism | Gaeumannomyces graminis var. tritici (strain R3-111a-1) (Wheat and barley take-all root rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Magnaporthaceae> Gaeumannomyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.976 |
| Instability index | 76.55 |
| Isoelectric point | 7.83 |
| Molecular weight | 31519.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | DNA-binding transcription factor activity GO:0003700 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29823
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.03| 24| 168| 76| 99| 4
---------------------------------------------------------------------------
76- 99 (40.80/21.10) SNGSSANASNGG.SSSSSGSKKQQQ
246- 270 (39.23/20.02) SSQSPTPPPLGGfSNVQKTSRKLQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.83| 19| 194| 6| 24| 5
---------------------------------------------------------------------------
6- 24 (38.48/17.68) NVYAPAPWAPRQANPDEDW
202- 220 (37.35/16.97) DVSNPAPYDHSNSHMNSSW
---------------------------------------------------------------------------
|