<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29817
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDTPQGEPAGSNNAPVDVHQPFTKAERMQQLSEIDQDISSLLELTSKALGALVTSPTAAEANDSAPEPNSANGSADAPPSAPAAPPTQEQREQQSRAFEAASNDFFATLLSVHVRLKRQIWGLEEAGIITLKDSGAKGTGGSAAAAAAAASAKGGAVAPTNLAVPALEPNGVGAIGNLDVGWLNSRSSKVDRDMEAELWAHARGHLEARANAVAAAISGAAVEGVPVDAQGDVDMALAD |
Length | 239 |
Position | Head |
Organism | Gaeumannomyces graminis var. tritici (strain R3-111a-1) (Wheat and barley take-all root rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Magnaporthaceae> Gaeumannomyces.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.232 |
Instability index | 37.19 |
Isoelectric point | 4.55 |
Molecular weight | 24244.42 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29817
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.14| 27| 62| 4| 30| 1
---------------------------------------------------------------------------
4- 30 (51.61/23.94) PQGEPA.GSNNAPVDV.HQPFTKAERMQQ
66- 94 (41.53/18.05) PEPNSAnGSADAPPSApAAPPTQEQREQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.36| 14| 14| 155| 168| 2
---------------------------------------------------------------------------
155- 168 (24.00/12.33) GAVAPTNLAVPALE
171- 184 (26.37/14.13) GVGAIGNLDVGWLN
---------------------------------------------------------------------------
|