<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29803

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEADATGGVGRGVGGLGGSVVDKGGGETAPAPAPVPAPGTVGSAPSGGDTTMTTTATTTPATMAMEQWTLFLSRCLATRLDPETFDSYVVLLYAKHPLPPRAVADVFLRPRPGNSDCLDPRIPPYLQILLAHQFVDALSILEAMYRYSTSHTQSRAGMPALKDGEDEKLTGGVNDAGGKNNGRRRQKQQPLVWGSSYAAEEHTFYRLTKSIAQGSGIRSVRDAIEIARVMARWMNLFTAAAAAFAADPMGPLQNSLPLQEMESARAGFVMLLLGLCESKLMLSSLSHVEAKVARKELSQSLANFVPSMVQSAAQIAARLEVFRTETLAGFEPVDKAIEAAQGEMNALLDSAVPPENLVLPEILISHTRAGLYIYVNSLLAGRPLMDDVAIFNYLHNRFQGNLQQMAIDLILASFDMIAHAATSRQPQRAAHVLRSYLTNKVPLLLVSLAASATPLYPLNAAACVEHAVRQVGSATFPNMSEYLVSSNRNGNTLTEGTREDFLFACCLHGLIPEARIVPILNEACINSLPPEGRLVKDNLVQECLADPEKTHQLVRNLDKCDGNVGAISQALVEVLGQLCDMKETMTLKTLCNQLARDPVYLDVLLLFDKLPTIVTPLCELLDNWRYDEDQGEFQPVYEEFGSVLLLLLAFIHRYNLTAADLGTRSADSFIAKLISRGHMALHLDELSEQEQSHLDKWIHGLFDSDAGGLGDELMSACPPQEFYLLIPTLFYNIVLAVSTGCLSEDSLKSGLEYLVDTFLLPALVPAIIYLCNHLWIDRSEEQKAIIRILQLIIAPSSISNEASTMLTSVLCMVAKPLDLALRTYQRQDVKNQDIDPLLRILKAQVPVSRRTGAADNNELDQWTGTPGGGINQAVRHTFRGLVSWSLAPPDPERTPTPYTHRQMLVALRLMRARGLLRLLLDEFRQQAVQGNEGVALDVCCALVCAPDSGAGEQPDEAAARQQHQQMNNMLDAAGGVVAPVPLPPQQQRLMSLRQALRYEAEDWKKIQRHDPAMAEAVVRLHRRVEEQMAVSDAAVAAAAAAATAAATAGMLQGGDINDMMAGDAAMAAAAAAVAAENTAGADGMSLDTSVGVGLDLGGGDLNLGGSSANSVGGLDGGLDLGDDMFRGLGPLDGLGGWDDVMDMS
Length1144
PositionTail
OrganismGaeumannomyces graminis var. tritici (strain R3-111a-1) (Wheat and barley take-all root rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Magnaporthales> Magnaporthaceae> Gaeumannomyces.
Aromaticity0.06
Grand average of hydropathy-0.004
Instability index46.58
Isoelectric point4.98
Molecular weight123144.44
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364142

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.58|      16|      16|     502|     517|       1
---------------------------------------------------------------------------
  502-  517 (30.61/18.44)	LFACCLHGLIPEARIV
  520-  535 (28.97/17.04)	LNEACINSLPPEGRLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      71.95|      19|      21|    1080|    1100|       2
---------------------------------------------------------------------------
 1080- 1100 (34.45/25.53)	GadGMSL..DTSVGVG.LD.LGGGD
 1105- 1116 (17.98/ 6.10)	G....SS..ANSVG.G.LD..G...
 1117- 1138 (19.52/ 6.68)	...GLDLgdDMFRGLGpLDgLGGWD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.76|      23|      28|    1026|    1048|       3
---------------------------------------------------------------------------
 1026- 1048 (38.21/20.50)	EQMAVSDAAVAAAAAAATAAATA
 1057- 1079 (41.55/22.91)	NDMMAGDAAMAAAAAAVAAENTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.59|      23|      27|     281|     306|       4
---------------------------------------------------------------------------
  255-  270 (22.62/11.19)	...SLPLQEME..SAR.......AGFVM
  281-  306 (34.21/29.17)	MLSSLSHVEAK..VARKElsqSLANFVP
  308-  332 (33.76/20.40)	MVQSAAQIAARleVFRTE...TLAGFEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.59|      19|      27|     667|     687|       5
---------------------------------------------------------------------------
  667-  686 (29.00/22.62)	DSFIAKLISRGHMALHlDEL
  695-  713 (35.59/18.18)	DKWIHGLFDSDAGGLG.DEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.24|      23|      33|     921|     953|       6
---------------------------------------------------------------------------
  921-  946 (34.35/34.57)	DE..FRQQAVQGNEgvALDVCCALVcAP
  955-  979 (38.89/14.13)	DEaaARQQHQQMNN..MLDAAGGVV.AP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.95|      25|      33|     407|     434|       7
---------------------------------------------------------------------------
  407-  434 (37.74/33.45)	IDLILASfdmIAHAATSRQPQRAA....HVLR
  441-  469 (37.21/23.05)	VPLLLVS...LAASATPLYPLNAAacveHAVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.93|      20|      28|     573|     594|       8
---------------------------------------------------------------------------
  573-  594 (27.32/32.09)	EVLgQLCDMKETMtLKTLCNQL
  602-  621 (34.61/26.55)	DVL.LLFDKLPTI.VTPLCELL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29803 with Med5 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEADATGGVGRGVGGLGGSVVDKGGGETAPAPAPVPAPGTVGSAPSGGDTTMTTTATTT
2) RAGMPALKDGEDEKLTGGVNDAGGKNNGRRRQK
1
155
59
187










Molecular Recognition Features






MoRF SequenceStartStop




NANANA