<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29801
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISHYKLLAHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHRDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHDSGGDHSKKHHEKKRKHEGMEDSADVHKHKKSKHKSSKTDDTGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Oryza brachyantha |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.591 |
| Instability index | 30.02 |
| Isoelectric point | 9.39 |
| Molecular weight | 25279.04 |
| Publications | PubMed=23481403
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29801
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.07| 20| 21| 133| 152| 1
---------------------------------------------------------------------------
150- 171 (29.59/ 7.05) HKDrsKDKDKDKDKDKKKDKSG
172- 191 (35.48/ 9.77) HHD..SGGDHSKKHHEKKRKHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.91| 11| 14| 123| 133| 2
---------------------------------------------------------------------------
123- 133 (21.53/ 8.33) KDKEKKHKKHR
139- 149 (22.38/ 8.95) KDKEHKKHKHR
---------------------------------------------------------------------------
|