<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29794
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEPEARPAPDPNDARQRFLLELEFVQCLANPIYIHYLAQNRYFEDEAFLGYLKYLMYWQRPQYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPAPATVPAAAPVPSPAVPPVAAPPSLPPMSAVGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKYALPLQSFISLVKLLVVHAVLFCSASLSL |
| Length | 226 |
| Position | Middle |
| Organism | Oryza brachyantha |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.189 |
| Instability index | 63.83 |
| Isoelectric point | 9.56 |
| Molecular weight | 25416.35 |
| Publications | PubMed=23481403
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.02| 23| 27| 118| 140| 1
---------------------------------------------------------------------------
118- 140 (48.14/17.39) PRP..PPEPTPAPAPAPATVPAAA..P
142- 168 (35.88/11.30) PSPavPPVAAPPSLPPMSAVGASAmsP
---------------------------------------------------------------------------
|