<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29758
Description |
Uncharacterized protein |
Sequence | XAGGGPGGAPGSGGSLDEARHRYKVAVSALRASIAAVSSCAQEMGSTEHSADQAEIERLEEHASSLRKEIESKNKHVKLLIDQLRDLISDISMWQSPCSV |
Length | 100 |
Position | Head |
Organism | Oryza brachyantha |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.407 |
Instability index | 58.19 |
Isoelectric point | 5.76 |
Molecular weight | 10471.56 |
Publications | PubMed=23481403
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29758
No repeats found
No repeats found
|