<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29731
Description |
Mediator of RNA polymerase II transcription subunit 24 (Fragment) |
Sequence | MIQEWLQVEGLRLWLQAQNDSRGAGKAPFLSPQSWPPPLPPAQSEIMKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHW |
Length | 176 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.004 |
Instability index | 60.27 |
Isoelectric point | 6.09 |
Molecular weight | 19960.07 |
Publications | PubMed=16625196
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29731
No repeats found
No repeats found
|
Associated diseases