<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29722
| Description |
Uncharacterized protein |
| Sequence | MDRDIEGLNCALNSVKVLRSNVRRVFETVSNGLRPDHGEDVKENKYILELQEFLTTVNNNLRDVENSVSNLTPPPGAFNLGNTAYLSQETTQEKQQLYGQLVNSYKWTDKVREYSALAGNILASNSFNKTYKTYSASKRRKNLTSTHIVTPEVIENLIMSIDRLFNDVTITTNRPFVPNPIIQVALGRVLKAIIAFKGLMIEYVVVKNLSESNDLWSESRYKVFKKVTENCHAAMCHFHSPMMPELAVRSFMHWFHSYITLFSAPCKRCSKHLNCNLPPTWRDLRSLEPYHEECK |
| Length | 295 |
| Position | Tail |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.396 |
| Instability index | 51.84 |
| Isoelectric point | 8.87 |
| Molecular weight | 33910.41 |
| Publications | PubMed=22516182
PubMed=23537049
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.59| 18| 18| 99| 116| 2
---------------------------------------------------------------------------
99- 116 (32.05/21.84) GQLVNSYKWTDKVREYSA
119- 136 (30.53/20.49) GNILASNSFNKTYKTYSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.17| 11| 25| 28| 43| 3
---------------------------------------------------------------------------
28- 43 (13.79/19.60) TVSNGLRpdhgeDVKE
56- 66 (20.38/10.97) TVNNNLR.....DVEN
---------------------------------------------------------------------------
|