<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29715

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMTNLLEIQGYHGDRDLVDIPETGEAIYDEPQDPDTEFARTLHRIWQEKGDFSQVSSNSLLEDQLRELNDDDKQSEPEDDQPRDDSLTANDVLELKQSVLRNLGDAQNELAVALDVVNLLLSDTPRHLNEEMQLPIPKQSLGVASIETTELTSYQALKKSKISITTKTESLQSAADIFERASTQIEQVNNQNDTFWSDCLSLRDNNWSLIPSSNIRESAFDLEKAAKDLKVSYAIDEASNEIKSVSTSSFDIKPSKTGKSKLNIPSRRSKRLKLSIINGSTVEICSPSKSSDNIDDLAQNENERITSLLDSLNNAQDASFDEDCFADLLTEANQIPIVITSSAEFIAIELDANRQLTLELVGEEEFIKDDENISVKCDVLLFGLKLLRLRSYRNRANDTNQVMKNLLDLIHYESFLEDLKSLFARMTNLLKLFNVLEAGYYMQKTHASDILGVFFDEKMPSIIGTQAQINFGRGSNKIMNLTLNSPNTVYVQSGQYLQRTTISQLKTLVFSDTEVALLNAIRGICSGLGNKSIWLIDEIDRCVIGKKAEEQISIRPLITDKGCDLIVHSINKQEVFSISSNTPVYNIELTNWLRLHVN
Length597
PositionHead
OrganismWallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) (Wallemia sebi (CBS 633.66))
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Wallemiomycotina> Wallemiomycetes> Wallemiales> Wallemiaceae> Wallemia.
Aromaticity0.06
Grand average of hydropathy-0.387
Instability index43.18
Isoelectric point4.65
Molecular weight67099.52
Publications
PubMed=22326418

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.43|      42|      54|     436|     477|       1
---------------------------------------------------------------------------
  436-  477 (72.92/64.57)	EAGYYMQKTHASDILGVFFDEKMPSIIGTQAQINFGRGSNKI
  491-  532 (68.51/60.12)	QSGQYLQRTTISQLKTLVFSDTEVALLNAIRGICSGLGNKSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.50|      27|      54|     178|     211|       2
---------------------------------------------------------------------------
  178-  208 (36.80/25.75)	ERASTQIEQVNnqNDTFwsDCLSLRDNNWSL
  235-  261 (39.70/14.95)	DEASNEIKSVS..TSSF..DIKPSKTGKSKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.65|      14|      58|      57|      70|       5
---------------------------------------------------------------------------
   57-   70 (24.36/11.92)	NSLLEDQLRELNDD
  117-  130 (25.29/12.60)	NLLLSDTPRHLNEE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29715 with Med17 domain of Kingdom Fungi
Unable to open file!