<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29712
Description |
Uncharacterized protein |
Sequence | MNTDQLESIKLKLTQSLESLQAFQLVLLNTQMPNWVEILNKYNNLLSHIHILNSFLIASQTNEMNPNNSLLKSAVFPKQPINQSVEHILHVLLRTKPYPHIEQHENDLIDTLELNNQDVTSTIEAHDERSKRANSLTQRIKNQYDWKLRVQLEQETSSTQLNDQLVSNLANYMSTGTLVD |
Length | 180 |
Position | Head |
Organism | Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) (Wallemia sebi (CBS 633.66)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Wallemiomycotina>
Wallemiomycetes> Wallemiales> Wallemiaceae> Wallemia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.524 |
Instability index | 51.26 |
Isoelectric point | 5.60 |
Molecular weight | 20785.20 |
Publications | PubMed=22326418
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29712
No repeats found
No repeats found
|