<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29707
| Description |
Uncharacterized protein (Fragment) |
| Sequence | DRTPEEYLEAFDDSLNNRVDTEVAQLSDGLSEIIGLAEIAKKDNYKISKEAFQISCRSESMIRSANSLLGITHALKMVNFLGDDQHRLDVSSARAGVLSEERRQAISELEAAMEQYMQ |
| Length | 118 |
| Position | Head |
| Organism | Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) (Wallemia sebi (CBS 633.66)) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Wallemiomycotina>
Wallemiomycetes> Wallemiales> Wallemiaceae> Wallemia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.464 |
| Instability index | 51.20 |
| Isoelectric point | 4.63 |
| Molecular weight | 13224.60 |
| Publications | PubMed=22326418
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29707
No repeats found
No repeats found
|