<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29703
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MMAGKVMAETEEQSRIRFQVELEFVQCLANPNYIHFLAQRGYMKEQTFVNYLRYLQYWREPEYARYLKYPMCLHFLELLQHEAFRRECVSAQVCKFMDDQAILLWQHYTRRRTRTLQPPDAPAPPAPPAAPQPPRQQS |
Length | 138 |
Position | Middle |
Organism | Papilio xuthus (Asian swallowtail butterfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.608 |
Instability index | 79.98 |
Isoelectric point | 8.72 |
Molecular weight | 16554.92 |
Publications | PubMed=22651552
PubMed=26354079
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29703
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 106.53| 24| 24| 48| 71| 1
---------------------------------------------------------------------------
22- 44 (22.58/ 9.16) ....LEFVQCLANPNYIHFLAqrgYMK
48- 71 (46.21/24.71) FVNYLRYLQYWREPEYARYLK...YPM
75- 97 (37.75/19.14) FLELLQHEAFRRECVSAQVCK...F.M
---------------------------------------------------------------------------
|