<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29701
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MECVVQGIIETQHVEALEILLQGLCGVQRERLRIHELCLKNGPHLGPVSSEVRLLCDLEQTEPSWTVRHVGGAMRGAGADQISVLVRTMVESKVSKNVLRMFYTLGYKLDHELLRVGFSFKFNRGAQITVRVSSVNKMLKLHATDEAVPVTPGIQMVEVTAPASDENYAEVAAAVQSFCEYLAPLLHLSKPGVSTGVVPTAAAAAASLMSDGGGTPL |
| Length | 217 |
| Position | Head |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.151 |
| Instability index | 35.36 |
| Isoelectric point | 6.16 |
| Molecular weight | 23347.78 |
| Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP29701
No repeats found
No repeats found
|