<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29691

Description WD repeat and HMG-box DNA binding protein 1
SequenceMPATQKPMRYGHTEGHTDVCFDDTGSCIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSCALKNGKLVTAVSNNTVQVHTFPEGVPDGILTRFTTNANHVVFNEDGTKIAAGSSDFLIKIVDVMDSSQQKTFRGHDAPVLSLSFDPKGVFLASASCDGSVRVWEISDQTCAISWPLLQKCNDMINAKSICRLAWQPKNGKLLAVPVEKSVKLYRRDTWNNQFDLSDSFISQTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGQISYTDAEGNLGLLENVCDSSGKMSSRKVSSRVEEDYNDLFDGDNTSNADDFLNDNAVEMPSFSRGAINDDDEDDLMLASKDDENSVDVTMLKTGLLKEEEEDQAGSIHNLPLITSQRPFYDGPIPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEHDNAIDVEFHDTSIHHATHLSNALNYTVADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPQNEDIEAICLGQGWAAAATSALLLRLFTIGGVQKEVFSLPGPVVSMAGHGEQLFIIYHRGTGFDGDQCLGVQLLELGKKKKQILHGDPLPLTRKSYLVWVGFSAEGTPCYVDSEGCVRMLNRGLGNTWTPVCNTREHCKGKSDHYWVIGVHENPQQLRCIPCKGSRFPPTLPRPAIAILSFKIPYCQMATEKGQMEEQFWRSVLFHNHLEYLAKNGYEYEESTKNQATKEQQELLMKMLALSCKLEREFRCVELADLMTQNAVNLAIKYASRSRKLLLAQKLSELAVEKAAELAATQAEEEEEEDFREKLNAGYSNTATEWSQPRPRNQIEQDAEDKEEADDTKEKPELHKHGEIYFLGFFLVKGAVISSNQGRVNPFKVLASSKEPAVSLNSTRSTNILDSMNKSSKKSSALNRAANNERSPVIKPLIPKPKSKQASAASYFQKRTSQASKTEEVKEENPKNESSETPAICPQNTENQRPKTGFQMWLEENRSNILTDNPDFSDEADIIKEGMIRFRVLSTEERKAWTNKAKGGTPSDETEGKKRKHAADESLEAENQKEAAKENLNLPKKQKPLDLSTNQKLSAFAFK
Length1106
PositionTail
OrganismIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae> Xerinae> Marmotini> Ictidomys.
Aromaticity0.07
Grand average of hydropathy-0.546
Instability index36.12
Isoelectric point5.40
Molecular weight123371.27
Publications









Function






Annotated function


GO - Cellular Component
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29691
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.99|      20|      27|     340|     359|       1
---------------------------------------------------------------------------
  340-  359 (33.93/22.68)	NDNAVEMPSFSRGAINDDDE
  369-  388 (31.07/20.16)	DENSVDVTMLKTGLLKEEEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     201.53|      37|     121|       5|      41|       2
---------------------------------------------------------------------------
    5-   41 (70.02/47.99)	QKPMRYGHTEGHTDVCFDDTGSCIVTCGSDGDVRIWE
   92-  120 (36.47/21.24)	....RFTTNANH..VVFNEDGTKIAAGSSDFLIKI..
  129-  164 (63.33/42.65)	QKTFR.GHDAPVLSLSFDPKGVFLASASCDGSVRVWE
  236-  258 (31.71/17.45)	..............VTWSPCGQYLAAGSINGLIIVWN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.75|      23|     112|     730|     753|       7
---------------------------------------------------------------------------
  730-  753 (35.94/27.39)	KNGYEYEESTKNQA..TKEQQElLMK
  843-  867 (34.82/21.56)	RNQIEQDAEDKEEAddTKEKPE.LHK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29691 with Med16 domain of Kingdom Metazoa
Unable to open file!