<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29690

Description Mediator of RNA polymerase II transcription subunit 1
SequenceESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMVRIVLLLNPGSISCLENLLYLPQVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNMKYYASPSDLLDDKTASPIILHENNVPRSLGMNASVTIEGTSTMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRTFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVNKITFQHPGRVPLILNIIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICPGSNKTKKKKSSRLPPDKPKHQTEDDFQRELFSMDVDSQNPIFDVNMAADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALSSLGVPMLGGDNGETKFKGNSQADTVDFSIISVAGKALGPADLLEHHSGSQSPLMTAGELGKEKTQKRIKEGNGTSNSSLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVSTPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSSSASTSGKMKSSKSEGSSSSKLSSGMYTSQGSSGSGQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPMDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKLSTSGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDREKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN
Length1575
PositionMiddle
OrganismIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae> Xerinae> Marmotini> Ictidomys.
Aromaticity0.05
Grand average of hydropathy-0.668
Instability index54.29
Isoelectric point8.86
Molecular weight167811.54
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl
nucleolus	GO:0005730	IEA:Ensembl
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
DNA binding	GO:0003677	IEA:Ensembl
estrogen receptor binding	GO:0030331	IEA:Ensembl
LBD domain binding	GO:0050693	IEA:Ensembl
nuclear receptor coactivator activity	GO:0030374	IEA:Ensembl
peroxisome proliferator activated receptor binding	GO:0042975	IEA:Ensembl
promoter-specific chromatin binding	GO:1990841	IEA:Ensembl
protein-containing complex binding	GO:0044877	IEA:Ensembl
retinoic acid receptor binding	GO:0042974	IEA:Ensembl
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription corepressor activity	GO:0003714	IEA:Ensembl
vitamin D receptor binding	GO:0042809	IEA:Ensembl

GO - Biological Process
androgen biosynthetic process	GO:0006702	IEA:Ensembl
angiogenesis	GO:0001525	IEA:Ensembl
animal organ regeneration	GO:0031100	IEA:Ensembl
brain development	GO:0007420	IEA:Ensembl
cell morphogenesis	GO:0000902	IEA:Ensembl
cellular response to epidermal growth factor stimulus	GO:0071364	IEA:Ensembl
cellular response to hepatocyte growth factor stimulus	GO:0035729	IEA:Ensembl
cellular response to thyroid hormone stimulus	GO:0097067	IEA:Ensembl
embryonic heart tube development	GO:0035050	IEA:Ensembl
embryonic hemopoiesis	GO:0035162	IEA:Ensembl
embryonic hindlimb morphogenesis	GO:0035116	IEA:Ensembl
embryonic placenta development	GO:0001892	IEA:Ensembl
enucleate erythrocyte development	GO:0048822	IEA:Ensembl
epithelial cell proliferation involved in mammary gland duct elongation	GO:0060750	IEA:Ensembl
fat cell differentiation	GO:0045444	IEA:Ensembl
intracellular steroid hormone receptor signaling pathway	GO:0030518	IEA:Ensembl
keratinocyte differentiation	GO:0030216	IEA:Ensembl
lactation	GO:0007595	IEA:Ensembl
lens development in camera-type eye	GO:0002088	IEA:Ensembl
liver development	GO:0001889	IEA:Ensembl
mammary gland branching involved in pregnancy	GO:0060745	IEA:Ensembl
mammary gland branching involved in thelarche	GO:0060744	IEA:Ensembl
megakaryocyte development	GO:0035855	IEA:Ensembl
monocyte differentiation	GO:0030224	IEA:Ensembl
mRNA transcription by RNA polymerase II	GO:0042789	IEA:Ensembl
negative regulation of apoptotic process	GO:0043066	IEA:Ensembl
negative regulation of keratinocyte proliferation	GO:0010839	IEA:Ensembl
negative regulation of neuron differentiation	GO:0045665	IEA:Ensembl
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:Ensembl
peroxisome proliferator activated receptor signaling pathway	GO:0035357	IEA:Ensembl
positive regulation of erythrocyte differentiation	GO:0045648	IEA:Ensembl
positive regulation of G0 to G1 transition	GO:0070318	IEA:Ensembl
positive regulation of gene expression	GO:0010628	IEA:Ensembl
positive regulation of hepatocyte proliferation	GO:2000347	IEA:Ensembl
positive regulation of interferon-gamma-mediated signaling pathway	GO:0060335	IEA:Ensembl
positive regulation of intracellular estrogen receptor signaling pathway	GO:0033148	IEA:Ensembl
positive regulation of keratinocyte differentiation	GO:0045618	IEA:Ensembl
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
protein import into nucleus	GO:0006606	IEA:Ensembl
regulation of vitamin D receptor signaling pathway	GO:0070562	IEA:Ensembl
retinal pigment epithelium development	GO:0003406	IEA:Ensembl
thyroid hormone generation	GO:0006590	IEA:Ensembl
thyroid hormone mediated signaling pathway	GO:0002154	IEA:Ensembl
ventricular trabecula myocardium morphogenesis	GO:0003222	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29690
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     301.77|      48|      50|    1064|    1111|       1
---------------------------------------------------------------------------
  972- 1015 (49.03/10.50)	LSG..PGLDSK....PGKRSR....TPSNDGKSKDKP..P.............KR.....KKADTE...GKSPSH...SS
 1020- 1071 (47.63/ 9.97)	FTP..PT..ST....GGSKSPGS.SGRSQTPPGVSTPpiP.............KItiqipKGTVMV...GKPSSH...SQ
 1072- 1122 (73.31/19.86)	YTS..SGSVSS....SGSKSHHSHSSSSSSSSSASTS..G.............KM.....KSSKSE...GSSSSKlssGM
 1123- 1162 (52.44/11.82)	YTS..QGS.SG....SGQSKNSSQSGGKPGSSPITKH..G.......................LSS...G..SSS...TK
 1163- 1213 (41.60/ 7.64)	MKP..QGKPSSlmnpSLSKPNISPSHSRPPGGSDKLA..S.............PM.....K....PvpgTPPSSK...AK
 1307- 1369 (37.76/ 6.16)	VTSgpGGEDPM....DGQMGVSTNSSSHPMSSKHNMS..GgefqgkreksdkdKS.....KLSTSG...GSVDSS...KK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     426.56|      71|      76|     793|     865|       4
---------------------------------------------------------------------------
  552-  606 (55.93/22.10)	....PT.N.TFP........GGpitTLFNMSM..............sIKDRHESvGHG..ED..F.SKVSQ.....NPILTSLLQITGN........GGST
  607-  654 (70.33/29.98)	IGSSPTpPHHTP........P........................P.V..SSMA.GNT..KNHPMLMNLLK....DNPAQDFSTLY...........GSSP
  661-  733 (66.67/27.98)	SSGSPR.MEICPgsnktkkkKS...SRLPPDKPKHQTED...................dfQRELFSMDV....DSQNPIFD.VNMAADTldtphitpAPSQ
  734-  779 (60.80/24.77)	CSTPPT.T..YP........QP...V........PHPQP..siQRM.VRLSSSD.SIG...................P..DVTDILSDI........AEEA
  780-  838 (81.26/40.58)	S.............................KL.PSTSDDcppiGTP.VRDSSSS.GHS..QSALFDSDVFQtnNNENPYTDPADLIADA........AGSP
  839-  898 (91.58/41.62)	SSDSPT.NHFFP........DG...VDFNPDLLNSQSQS..gfGEE.YFDES.....S..QSG..DNDDFK.........GFASQALSS........LGVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     227.70|      50|      50|     313|     362|       5
---------------------------------------------------------------------------
  273-  311 (31.62/15.28)	............WTPSFSSITsansvdlpaCFFL.KFPQPIPVSRT..................F...VQKL...Q..
  313-  362 (94.56/63.64)	CTGIPLFETQPTYVPLYELIT.........QFELSKDPDPIPLNHN.M...............RF...YAALPGQQHC
  373-  413 (44.57/25.24)	.......DGRSLQGTLVNKIT..........F...QHPGRVPLILNiI...............RHqvaYNTLIGS..C
  423-  478 (56.95/34.74)	SPGLLQFEV....CPLSE..S.........RFSVSFQH...PVNDS.LvcvvmdvqdsthvscKL...YKGLSDALIC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     133.02|      40|     340|     901|     945|       6
---------------------------------------------------------------------------
  905-  945 (65.28/37.34)	GETKFKGNSQAdTVDFSIISVAGKALGPADLLEHHSGSQSP
 1248- 1287 (67.73/27.35)	QKTPPSSNSSC.TASSSSFSSSGSSMSSSQNQHGSSKGKSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     112.27|      25|      82|    1371|    1395|       7
---------------------------------------------------------------------------
 1371- 1395 (42.77/19.95)	SESKNVGST..GVAKIIISKHDGGSPS
 1401- 1427 (37.14/16.32)	TLQKPGESSgeGLRPQMASSKNYGSPL
 1455- 1473 (32.36/13.23)	SESES.GSS.......IAEKSYQNSPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     147.06|      45|      48|     141|     188|       9
---------------------------------------------------------------------------
  141-  188 (70.75/47.31)	KHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQDLSKMAIMYWKatNAGP
  191-  237 (76.31/41.95)	KILHGSVG.YLTPrsGGHLMNMKYYASPSDLLDDKTASPIILHE..NNVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.95|      12|      21|    1487|    1498|      10
---------------------------------------------------------------------------
 1487- 1498 (19.59/11.47)	EKHKKHKKEKKK
 1503- 1514 (18.35/10.26)	DRDRDRDKDRDR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29690 with Med1 domain of Kingdom Metazoa
Unable to open file!