<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29689
| Description |
POU domain protein |
| Sequence | MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAGGGGGLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY |
| Length | 294 |
| Position | Head |
| Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.413 |
| Instability index | 53.28 |
| Isoelectric point | 9.57 |
| Molecular weight | 32123.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | chromatin GO:0000785 IEA:Ensembl
cytoplasm GO:0005737 IEA:Ensembl
neuron projection GO:0043005 IEA:Ensembl
RNA polymerase II transcription regulator complex GO:0090575 IEA:Ensembl
|
| GO - Biological Function | chromatin binding GO:0003682 IEA:Ensembl
DNA-binding transcription activator activity, RNA polymerase II-specific GO:0001228 IEA:Ensembl
GTPase binding GO:0051020 IEA:Ensembl
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:Ensembl
single-stranded DNA binding GO:0003697 IEA:Ensembl
|
| GO - Biological Process | cell migration in hindbrain GO:0021535 IEA:Ensembl
cellular response to cytokine stimulus GO:0071345 IEA:Ensembl
cellular response to estradiol stimulus GO:0071392 IEA:Ensembl
central nervous system neuron differentiation GO:0021953 IEA:Ensembl
habenula development GO:0021986 IEA:Ensembl
innervation GO:0060384 IEA:Ensembl
intrinsic apoptotic signaling pathway by p53 class mediator GO:0072332 IEA:Ensembl
mesoderm development GO:0007498 IEA:Ensembl
negative regulation of gene expression GO:0010629 IEA:Ensembl
negative regulation of neuron apoptotic process GO:0043524 IEA:Ensembl
negative regulation of transcription by RNA polymerase II GO:0000122 IEA:Ensembl
negative regulation of transcription elongation by RNA polymerase I GO:2001208 IEA:Ensembl
neuron fate specification GO:0048665 IEA:Ensembl
neuron projection development GO:0031175 IEA:Ensembl
peripheral nervous system neuron development GO:0048935 IEA:Ensembl
positive regulation of apoptotic process GO:0043065 IEA:Ensembl
positive regulation of cell cycle arrest GO:0071158 IEA:Ensembl
positive regulation of gene expression GO:0010628 IEA:Ensembl
positive regulation of osteoclast differentiation GO:0045672 IEA:Ensembl
positive regulation of transcription regulatory region DNA binding GO:2000679 IEA:Ensembl
proprioception involved in equilibrioception GO:0051355 IEA:Ensembl
regulation of DNA-binding transcription factor activity GO:0051090 IEA:Ensembl
regulation of neurogenesis GO:0050767 IEA:Ensembl
sensory system development GO:0048880 IEA:Ensembl
suckling behavior GO:0001967 IEA:Ensembl
trigeminal nerve development GO:0021559 IEA:Ensembl
ventricular compact myocardium morphogenesis GO:0003223 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP29689
No repeats found
|