<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29688
| Description |
Uncharacterized protein |
| Sequence | MAAPQQQASVASSAGGVSGPGSTGGPGSQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
| Length | 200 |
| Position | Tail |
| Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.375 |
| Instability index | 67.54 |
| Isoelectric point | 5.86 |
| Molecular weight | 21100.70 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29688
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.22| 14| 167| 14| 27| 1
---------------------------------------------------------------------------
14- 27 (27.29/10.51) AGGVSG..PGSTGGPG
182- 197 (22.93/ 7.95) ANKVTGktPAPPTGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.02| 20| 22| 29| 48| 2
---------------------------------------------------------------------------
29- 48 (36.95/14.72) QQQPQPPAQ...LVGPAQSGLLQ
50- 72 (31.07/11.53) QQQDFDPVQrykMLIPQLKESLQ
---------------------------------------------------------------------------
|