<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29685
| Description |
Cyclin C |
| Sequence | MAGNFWQSSHIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 246 |
| Position | Kinase |
| Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.085 |
| Instability index | 49.00 |
| Isoelectric point | 7.57 |
| Molecular weight | 28510.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
identical protein binding GO:0042802 IEA:Ensembl
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29685
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 178| 191| 1
---------------------------------------------------------------------------
178- 191 (20.63/18.10) QW..FAELSvDMEKIL
203- 217 (20.73/12.79) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|