<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29682
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGTQAIVSQMPVAEGKSVQQTVELLTRKLETLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWNLLLEFLQSFLGSHTPGAPAVFGNRHDVVYGPADTMVQYMELFNKIRKQQQVPVAGIR |
Length | 213 |
Position | Head |
Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.009 |
Instability index | 29.78 |
Isoelectric point | 6.42 |
Molecular weight | 23326.60 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29682
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.46| 26| 37| 122| 147| 1
---------------------------------------------------------------------------
122- 147 (47.59/30.51) DFLVK.VGTVTMG.PSARGISVEVEYGP
160- 187 (41.87/26.09) EFLQSfLGSHTPGaPAVFGNRHDVVYGP
---------------------------------------------------------------------------
|