<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29659
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFTGQPPGPPPPPPGLLGQASLLQATPGIPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADLPQGSLAYLEQASANIPAPMKQS |
| Length | 178 |
| Position | Head |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.465 |
| Instability index | 59.66 |
| Isoelectric point | 5.39 |
| Molecular weight | 19683.17 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
mediator complex GO:0016592 IBA:GO_Central
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP29659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.58| 24| 134| 12| 37| 1
---------------------------------------------------------------------------
12- 37 (44.22/25.85) QPPGPPPPPPGLLgqASLLQATPGIP
149- 172 (44.36/20.62) QHKKPADLPQGSL..AYLEQASANIP
---------------------------------------------------------------------------
|