<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29647
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MASVDFRDNLLGISWVDSNWVPGLNPGNVLEYFSDRSNPFYDRTCNNEVVKMQRLTVDHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVVPLADYYIIAGVVYQAPDLGTVISSRVLSAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEREKAKPKTKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPAETVKQEEREQATKSSAPAPPNKPPPEKRARLQ |
| Length | 246 |
| Position | Head |
| Organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Cichlomorphae> Cichliformes> Cichlidae> African cichlids>
Pseudocrenilabrinae> Oreochromini> Oreochromis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.719 |
| Instability index | 53.97 |
| Isoelectric point | 8.68 |
| Molecular weight | 28336.92 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.02| 11| 19| 79| 89| 1
---------------------------------------------------------------------------
79- 89 (20.77/15.02) YIIRKQQRQSP
99- 109 (20.25/14.47) YIIAGVVYQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.00| 20| 41| 149| 168| 2
---------------------------------------------------------------------------
149- 168 (36.32/19.30) FKDH....................EEREKAKP.KTKKKEEP
172- 212 (19.90/ 7.68) FQRHrvdtllldlrskfpptfyqpKPGEKPIPvEVKKEPEP
219- 234 (20.78/ 8.31) ...Q....................EEREQA.T.KSSAPAPP
---------------------------------------------------------------------------
|