<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29647

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMASVDFRDNLLGISWVDSNWVPGLNPGNVLEYFSDRSNPFYDRTCNNEVVKMQRLTVDHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVVPLADYYIIAGVVYQAPDLGTVISSRVLSAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEREKAKPKTKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPAETVKQEEREQATKSSAPAPPNKPPPEKRARLQ
Length246
PositionHead
OrganismOreochromis niloticus (Nile tilapia) (Tilapia nilotica)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Cichlomorphae> Cichliformes> Cichlidae> African cichlids> Pseudocrenilabrinae> Oreochromini> Oreochromis.
Aromaticity0.09
Grand average of hydropathy-0.719
Instability index53.97
Isoelectric point8.68
Molecular weight28336.92
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	PIRNR:PIRNR023869

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.02|      11|      19|      79|      89|       1
---------------------------------------------------------------------------
   79-   89 (20.77/15.02)	YIIRKQQRQSP
   99-  109 (20.25/14.47)	YIIAGVVYQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.00|      20|      41|     149|     168|       2
---------------------------------------------------------------------------
  149-  168 (36.32/19.30)	FKDH....................EEREKAKP.KTKKKEEP
  172-  212 (19.90/ 7.68)	FQRHrvdtllldlrskfpptfyqpKPGEKPIPvEVKKEPEP
  219-  234 (20.78/ 8.31)	...Q....................EEREQA.T.KSSAPAPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29647 with Med6 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FYQPKPGEKPIPVEVKKEPEPPAETVKQEEREQATKSSAPAPPNKPPPEKRARLQ
192
246










Molecular Recognition Features






MoRF SequenceStartStop




1) IPVEVKKEPEPPAETVKQEEREQATKSSAPAPPNKPPPEKRARLQ
202
246